CEND1 Rabbit monoclonal antibody

Size

POA

SKU:: A5930
Additional Names:: BM88|CEND1
Application:: ELISA, WB, IF
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ALLNNHSNLKPAPTVPSSPDATPEPKGPGDGAEEDEAASGGPGGRGPWSCENFNPLLVAGGVAVAAIALILGVAFLVRKK
Uniprot:: Q8N111
Synonyms:: BM88;BM88 antigen;cell cycle exit and neuronal differentiation protein 1
Extra Details:: The protein encoded by this gene is a neuron-specific protein. The similar protein in pig enhances neuroblastoma cell differentiation in vitro and may be involved in neuronal differentiation in vivo. Multiple pseudogenes have been reported for this gene.