[KO Validated] FUS Rabbit polyclonal antibody

Size

POA

SKU:: A5921
Additional Names:: ALS6|altFUS|ETM4|FUS1|HNRNPP2|POMP75|TLS|US
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Uniprot:: P35637
Synonyms:: 75 kDa DNA-pairing protein;ALS6;altFUS;ETM4;fus-like protein;FUS1;fused in sarcoma;fusion gene in myxoid liposarcoma;heterogeneous nuclear ribonucleoprotein P2;HNRNPP2;oncogene FUS;oncogene TLS;POMP75;RNA-binding protein FUS;TLS;translocated in liposarcoma protein
Extra Details:: This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Shipping Conditions:: Blue Ice