ETF1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5920
Additional Names:: D5S1995|ERF|ERF1|ETF1|RF1|SUP45L1|TB3-1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VKFIQEKKLIGRYFDEISQDTGKYCFGVEDTLKALEMGAVEILIVYENLDIMRYVLHCQGTEEEKILYLTPEQEKDKSHFTDKETGQEHELIESMPLLEWFANNYKKFGATLEIVTDKSQEGSQFVKGFGGIGGILRYRVDFQGMEYQGGDDEFFDLDDY
Uniprot:: P62495
Synonyms:: D5S1995;ERF;ERF1;eukaryotic peptide chain release factor subunit 1;polypeptide chain release factor 1;protein Cl1;RF1;sup45 (yeast omnipotent suppressor 45) homolog-like 1;SUP45L1;TB3-1
Extra Details:: This gene encodes a class-1 polypeptide chain release factor. The encoded protein plays an essential role in directing termination of mRNA translation from the termination codons UAA, UAG and UGA. This protein is a component of the SURF complex which promotes degradation of prematurely terminated mRNAs via the mechanism of nonsense-mediated mRNA decay (NMD). Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 6, 7, and X.