A5915
CSTF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5915
- Additional Names:
- CstF-50|CSTF1|CstFp50
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 50kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MYRTKVGLKDRQQLYKLIISQLLYDGYISIANGLINEIKPQSVCAPSEQLLHLIKLGMENDDTAVQYAIGRSDTVAPGTGIDLEFDADVQTMSPEASEYETCYVTSHKGPCRVATYSRDGQLIATGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEML
- Uniprot:
- Q05048
- Synonyms:
- CF-1 50 kDa subunit;cleavage stimulation factor 50 kDa subunit;cleavage stimulation factor subunit 1;cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kD;cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa;CSTF 50 kDa subunit;CstF-50;CstFp50
- Extra Details:
- This gene encodes one of three subunits which combine to form cleavage stimulation factor (CSTF). CSTF is involved in the polyadenylation and 3'end cleavage of pre-mRNAs. Similar to mammalian G protein beta subunits, this protein contains transducin-like repeats. Several transcript variants with different 5' UTR, but encoding the same protein, have been found for this gene.
- Shipping Conditions:
- Blue Ice