A5908
ATM Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5908
- Additional Names:
- AT1|ATA|ATC|ATD|ATDC|ATE|ATM|TEL1|TELO1
- Application:
- ELISA, WB
- Molecular Weight:
- 310kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- CLDKKSQRTMLAVVDYMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEGSQSTTISSLSEKSKEETGIS
- Uniprot:
- Q13315
- Synonyms:
- A-T mutated;AT mutated;AT1;ATA;ataxia telangiectasia mutated;ATC;ATD;ATDC;ATE;serine-protein kinase ATM;TEL1;TEL1, telomere maintenance 1, homolog;TELO1
- Extra Details:
- The protein encoded by this gene belongs to the PI3/PI4-kinase family. This protein is an important cell cycle checkpoint kinase that phosphorylates; thus, it functions as a regulator of a wide variety of downstream proteins, including tumor suppressor proteins p53 and BRCA1, checkpoint kinase CHK2, checkpoint proteins RAD17 and RAD9, and DNA repair protein NBS1. This protein and the closely related kinase ATR are thought to be master controllers of cell cycle checkpoint signaling pathways that are required for cell response to DNA damage and for genome stability. Mutations in this gene are associated with ataxia telangiectasia, an autosomal recessive disorder.
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)