A5896
AATF Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5896
- Additional Names:
- AATF|BFR2|CHE-1|CHE1|DED
- Application:
- ELISA, WB
- Molecular Weight:
- 80-90kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLASASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISD
- Uniprot:
- Q9NY61
- Synonyms:
- Apoptosis-antagonizing transcription factor;BFR2;CHE-1;CHE1;DED;protein AATF;rb-binding protein Che-1
- Extra Details:
- The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
- Shipping Conditions:
- Blue Ice