A5884
ATP5A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5884
- Additional Names:
- ATP5A|ATP5A1|ATP5AL2|ATPM|COXPD22|hATP1|HEL-S-123m|MC5DN4|MOM2|OMR|ORM
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 53kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLSVRVAAAVVRALPRRAGLVSRNALGSSFIAARNFHASNTHLQKTGTAEMSSILEERILGADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGIIPRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATAS
- Uniprot:
- P25705
- Synonyms:
- ATP synthase alpha chain, mitochondrial;ATP synthase F1 subunit alpha;ATP synthase subunit alpha, mitochondrial;ATP synthase, H+ transporting, mitochondrial F1 complex, alpha subunit 1, cardiac muscle;ATP sythase (F1-ATPase) alpha subunit;ATP5A;ATP5A1;ATP5AL2;ATPM;COXPD22;epididymis secretory sperm binding protein Li 123m;hATP1;HEL-S-123m;MC5DN4;mitochondrial ATP synthetase, oligomycin-resistant;MOM2;OMR;ORM
- Extra Details:
- This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, using an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the alpha subunit of the catalytic core. Alternatively spliced transcript variants encoding the different isoforms have been identified. Pseudogenes of this gene are located on chromosomes 9, 2, and 16.
- Shipping Conditions:
- Blue Ice