A5879
KTN1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5879
- Additional Names:
- CG1|KNT|KTN1|MU-RMS-40.19
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 166kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEFYESAYFIVLIPSIVITVIFLFFWLFMKETLYDEVLAKQKREQKLIPTKTDKKKAEKKKNKKKEIQNGNLHESDSESVPRDFKLSDALAVEDDQVAPV
- Uniprot:
- Q86UP2
- Synonyms:
- CG-1 antigen;CG1;kinectin;kinesin receptor;KNT;MU-RMS-40.19
- Extra Details:
- This gene encodes an integral membrane protein that is a member of the kinectin protein family. The encoded protein is primarily localized to the endoplasmic reticulum membrane. This protein binds kinesin and may be involved in intracellular organelle motility. This protein also binds translation elongation factor-delta and may be involved in the assembly of the elongation factor-1 complex. Alternate splicing results in multiple transcript variants of this gene.
- Shipping Conditions:
- Blue Ice





