A5875
SF3B2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5875
- Additional Names:
- CFM|Cus1|HFM|SAP145|SF3b1|SF3B145|SF3b150|SF3B2
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 140 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLGMPVGPNAHKVPPPWLIAMQRYGPPPSYPNLKIPGLNSPIPESCSFGYHAGGWGKPPVDETGKPLYGDVFGTNAAEFQTKTEEEEIDRTPWGELEPSDEESSEEEEEEESDEDKPDETGFITPADSGLITPGGFSSVPAGMETPELIELRKKKIEEAMDGSETPQLFTVLPEKRTATVGGAMMGSTHIYDMSTVMSRKGPAPELQGVEVALAPEELELDPMAMTQKYEEHVREQQAQVEKEDFSDMVAEHAAKQKQKKRKAQPQDSRGGSKKYKEFKF
- Uniprot:
- Q13435
- Synonyms:
- Cus1;pre-mRNA splicing factor SF3b 145 kDa subunit;Pre-mRNA-splicing factor SF3b 145 kDa subunit;SAP 145;SAP145;SF3b1;SF3B145;SF3b150;spliceosome associated protein 145;Spliceosome-associated protein 145;splicing factor 3B subunit 2;splicing factor 3b, subunit 2, 145kD;splicing factor 3b, subunit 2, 145kDa
- Extra Details:
- This gene encodes subunit 2 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence-independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 2 associates with pre-mRNA upstream of the branch site at the anchoring site. Subunit 2 also interacts directly with subunit 4 of the splicing factor 3b complex. Subunit 2 is a highly hydrophilic protein with a proline-rich N-terminus and a glutamate-rich stretch in the C-terminus.
- Shipping Conditions:
- Blue Ice








