A5863
PLZF Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5863
- Additional Names:
- PLZF|ZNF145
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- TKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGRE
- Uniprot:
- Q05516
- Synonyms:
- PLZF;promyelocytic leukaemia zinc finger;Promyelocytic leukemia zinc finger protein;zinc finger and BTB domain-containing protein 16;Zinc finger protein 145;zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia);zinc finger protein PLZF;ZNF145
- Extra Details:
- This gene is a member of the Krueppel C2H2-type zinc-finger protein family and encodes a zinc finger transcription factor that contains nine Kruppel-type zinc finger domains at the carboxyl terminus. This protein is located in the nucleus, is involved in cell cycle progression, and interacts with a histone deacetylase. Specific instances of aberrant gene rearrangement at this locus have been associated with acute promyelocytic leukemia (APL). Alternate transcriptional splice variants have been characterized.
- Shipping Conditions:
- Blue Ice



_WB_01.jpg)

