A5857
UCP1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5857
- Additional Names:
- SLC25A7|UCP|UCP1
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- YTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILADDVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPN
- Uniprot:
- P25874
- Synonyms:
- mitochondrial brown fat uncoupling protein 1;SLC25A7;solute carrier family 25 member 7;thermogenin;UCP;uncoupling protein 1 (mitochondrial, proton carrier)
- Extra Details:
- Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat.
- Shipping Conditions:
- Blue Ice





