ITGB3BP Rabbit polyclonal antibody

Size

£152.00

SKU:: A5839
Additional Names:: CENP-R|CENPR|HSU37139|ITGB3BP|NRIF3|TAP20
Application:: ELISA, WB
Molecular Weight:: 20-25kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQ
Uniprot:: Q13352
Synonyms:: beta 3 endonexin;Beta-3-endonexin;beta3-endonexin;CENP-R;CENPR;centromere protein R;HSU37139;integrin beta 3 binding protein (beta3-endonexin);integrin beta-3-binding protein;NRIF3;nuclear receptor-interacting factor 3;TAP20
Extra Details:: This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice