A5836
PRODH Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5836
- Additional Names:
- HSPOX2|PIG6|POX|PRODH|PRODH1|PRODH2|TP53I6
- Application:
- ELISA, WB
- Molecular Weight:
- 68kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- IDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA
- Uniprot:
- O43272
- Synonyms:
- HSPOX2;p53-induced gene 6 protein;PIG6;POX;PRODH1;PRODH2;proline dehydrogenase (oxidase) 1;proline dehydrogenase 1, mitochondrial;Proline oxidase;proline oxidase 2;proline oxidase, mitochondrial;TP53I6;tumor protein p53 inducible protein 6
- Extra Details:
- This gene encodes a mitochondrial protein that catalyzes the first step in proline degradation. Mutations in this gene are associated with hyperprolinemia type 1 and susceptibility to schizophrenia 4 (SCZD4). This gene is located on chromosome 22q11.21, a region which has also been associated with the contiguous gene deletion syndromes, DiGeorge and CATCH22. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice