A5828
NEIL1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5828
- Additional Names:
- FPG1|hFPG1|NEI1|NEIL1
- Application:
- ELISA, WB
- Molecular Weight:
- 44kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQEPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGP
- Uniprot:
- Q96FI4
- Synonyms:
- DNA endonuclease eight-like glycosylase 1;DNA glycosylase/AP lyase Neil1;DNA-(apurinic or apyrimidinic site) lyase Neil1;endonuclease 8-like 1;endonuclease VIII;endonuclease VIII-like 1;FPG1;hFPG1;NEH1;nei endonuclease VIII-like 1;nei homolog 1;nei-like protein 1;NEI1
- Extra Details:
- This gene is a member of the Nei endonuclease VIII-like gene family which encodes DNA glycosylases. The encoded enzyme participates in the DNA repair pathway by initiating base excision repair by removing damaged bases, primarily oxidized pyrimidines. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice