MBL2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5825
Additional Names:: COLEC1|HSMBPC|MBL|MBL2|MBL2D|MBP|MBP-C|MBP1|MBPD
Application:: ELISA, WB, IHC-P
Molecular Weight:: 26kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Uniprot:: P11226
Synonyms:: COLEC1;collectin-1;HSMBPC;mannan-binding lectin;Mannan-binding protein;Mannose-binding lectin;mannose-binding lectin (protein C) 2, soluble (opsonic defect);mannose-binding lectin 2, soluble (opsonic defect);mannose-binding protein C;MBL;MBL2D;MBP;MBP-C;MBP1;MBPD
Extra Details:: This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes and binds to mannose and N-acetylglucosamine on many microorganisms, including bacteria, yeast, and viruses including influenza virus, HIV and SARS-CoV. This binding activates the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases.

Shipping Conditions:: Blue Ice