KAT7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5823
Additional Names:: HBO1|HBOA|KAT7|MYST2|ZC2HC7
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 63kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSL
Uniprot:: O95251
Synonyms:: HBO1;HBOA;histone acetyltransferase binding to ORC1;histone acetyltransferase KAT7;histone acetyltransferase MYST2;K(lysine) acetyltransferase 7;Lysine acetyltransferase 7;MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2;MYST histone acetyltransferase 2;MYST2;ZC2HC7
Extra Details:: The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed.