CXXC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5814
Additional Names:: 2410002I16Rik|5830420C16Rik|CFP1|CGBP|CXXC1|hCGBP|HsT2645|PCCX1|PHF18|SPP1|ZCGPC1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MKLAANRIYEILPQRIQQWQQSPCIAEEHGKKLLERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDTDLQIFCVSCGHPINPRVALRHMERCYAKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVPADEVCGCPLVRDVFELTGDFCRLPKRQCNRHYCWEKLRRAEVDLERVRVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPLTTDLRSSADR
Uniprot:: Q9P0U4
Synonyms:: 2410002I16Rik;5830420C16Rik;CFP1;CGBP;CpG binding protein;cpG-binding protein;CXXC finger 1 (PHD domain);CXXC-type zinc finger protein 1;DNA-binding protein with PHD finger and CXXC domain;hCGBP;HsT2645;PCCX1;PHD finger and CXXC domain-containing protein 1;PHF18;SPP1;ZCGPC1;zinc finger, CpG binding-type containing 1
Extra Details:: This gene encodes a protein that functions as a transcriptional activator that binds specifically to non-methylated CpG motifs through its CXXC domain. The protein is a component of the SETD1 complex, regulates gene expression and is essential for vertebrate development.