BBOX1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5810
Additional Names:: BBH|BBOX|BBOX1|G-BBH|gamma-BBH
Application:: ELISA, WB, IF
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDVNIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
Uniprot:: O75936
Synonyms:: BBH;BBOX;butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1;G-BBH;gamma-BBH;gamma-butyrobetaine dioxygenase;Gamma-butyrobetaine hydroxylase;Gamma-butyrobetaine,2-oxoglutarate dioxygenase;gamma-butyrobetaine,2-oxoglutarate dioxygenase 1
Extra Details:: This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation.