A5795
Cortactin Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5795
- Additional Names:
- Cortactin|EMS1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DYSKGFGGKYGVQKDRMDKNASTFEDVTQVSSAYQKTVPVEAVTSKTSNIRANFENLAKEKEQEDRRKAEAERAQRMAKERQEQEEARRKLEEQARAKTQ
- Uniprot:
- Q14247
- Synonyms:
- 1110020L01Rik;amplaxin;EMS1;ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 src substrate);epididymis secretory sperm binding protein;oncogene EMS1;src substrate cortactin
- Extra Details:
- This gene is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. The encoded protein is localized in the cytoplasm and in areas of the cell-substratum contacts. This gene has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells. During apoptosis, the encoded protein is degraded in a caspase-dependent manner. The aberrant regulation of this gene contributes to tumor cell invasion and metastasis. Three splice variants that encode different isoforms have been identified for this gene.
- Shipping Conditions:
- Blue Ice





_WB_01.jpg)
_WB_02.jpg)

