CD22 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5790
Additional Names:: CD22|SIGLEC-2|SIGLEC2
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 140kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH
Uniprot:: P20273
Synonyms:: B-cell receptor CD22;B-lymphocyte cell adhesion molecule;BL-CAM;CD22 antigen;sialic acid-binding Ig-like lectin 2;SIGLEC-2;SIGLEC2;T-cell surface antigen Leu-14
Extra Details:: Predicted to enable CD4 receptor binding activity; protein phosphatase binding activity; and sialic acid binding activity. Involved in B cell activation; negative regulation of B cell receptor signaling pathway; and regulation of endocytosis. Located in early endosome and recycling endosome.