ANP32A Rabbit polyclonal antibody

Size

£152.00

SKU:: A5768
Additional Names:: ANP32A|C15orf1|HPPCn|I1PP2A|LANP|MAPM|PHAP1|PHAPI|PP32
Application:: ELISA, WB, IHC-P
Molecular Weight:: 28kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEMGRRIHLELRNRTPSDVKELVLDNSRSNEGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGLEVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
Uniprot:: P39687
Synonyms:: acidic (leucine-rich) nuclear phosphoprotein 32 family, member A;acidic leucine-rich nuclear phosphoprotein 32 family member A;acidic nuclear phosphoprotein pp32;C15orf1;cerebellar leucine rich acidic nuclear protein;epididymis secretory sperm binding protein;hepatopoietin Cn;HPPCn;I1PP2A;inhibitor-1 of protein phosphatase-2A;LANP;leucine-rich acidic nuclear protein;MAPM;mapmodulin;PHAP1;PHAPI;potent heat-stable protein phosphatase 2A inhibitor I1PP2A;PP32;putative HLA-DR-associated protein I;putative human HLA class II associated protein I
Extra Details:: Enables RNA binding activity. Involved in nucleocytoplasmic transport. Located in endoplasmic reticulum; nucleus; and perinuclear region of cytoplasm.