A5761
p53 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5761
- Additional Names:
- BCC7|BMFS5|LFS1|P53|TRP53
- Application:
- ELISA, WB, IP
- Molecular Weight:
- 53kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EPPEAGSEYTTIHYKYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRDSFEVRVCACPGRDRRTEEENFRKKEVLCPELPPGSAKRALPTCTSASPPQKKKPLDGEYFTLKIRGRKRFEMFRELNEALELKDAHATEESGDSRAHSSYLKTKKGQSTSRHKKTMVKKVGPDSD
- Uniprot:
- P04637
- Synonyms:
- antigen NY-CO-13;BCC7;BMFS5;cellular tumor antigen p53;LFS1;mutant tumor protein 53;P53;p53 tumor suppressor;phosphoprotein p53;transformation-related protein 53;TRP53;tumor protein 53;Tumor suppressor p53;tumor supressor p53
- Extra Details:
- This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277).
- Shipping Conditions:
- Blue Ice



