Tryptophanyl-tRNA synthetase 1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5758
Additional Names:: GAMMA-2|HMN9|IFI53|IFP53|Tryptophanyl-tRNA synthetase 1|WARS
Application:: ELISA, WB
Molecular Weight:: 53-55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPNSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGIDYDKLIVRFGSSKIDKELINRIERATGQRPHHFLRRGIFFSHRDMNQVLDAYENKKPFYLYTGRGPSSEAMHVGHLIPFIFTKWLQDVFNVPLVIQMTDDEKYLWKDLTLDQAYSYAVENAKDIIACGFDINKTFIFSDLDYMGMSSGFYKNVVKIQKHVTFNQVKGIFGFT
Uniprot:: P23381
Synonyms:: epididymis secretory sperm binding protein;GAMMA-2;HMN9;hWRS;IFI53;IFP53;interferon-induced protein 53;trpRS;tryptophan tRNA ligase 1, cytoplasmic;tryptophan--tRNA ligase, cytoplasmic;Tryptophanyl-tRNA synthetase;WARS
Extra Details:: Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice