CLCN1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5739
Additional Names:: CLC1|CLCN1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 109kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ARPTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTLFSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAPPSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESPGLEEELADILQGPSLRSTDEEDEDELIL
Uniprot:: P35523
Synonyms:: chloride channel 1, skeletal muscle;chloride channel protein 1;chloride channel protein, skeletal muscle;chloride channel, voltage-sensitive 1;clC-1;CLC1
Extra Details:: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. The protein encoded by this gene regulates the electric excitability of the skeletal muscle membrane. Mutations in this gene cause two forms of inherited human muscle disorders: recessive generalized myotonia congenita (Becker) and dominant myotonia (Thomsen). Alternative splicing results in multiple transcript variants.