A5733
QDPR Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5733
- Additional Names:
- DHPR|HDHPR|PKU2|QDPR|SDR33C1
- Application:
- ELISA, WB
- Molecular Weight:
- 26kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
- Uniprot:
- P09417
- Synonyms:
- 6,7-dihydropteridine reductase;DHPR;dihydropteridine reductase;HDHPR;PKU2;Quinoid dihydropteridine reductase;SDR33C1;short chain dehydrogenase/reductase family 33C member 1;testis secretory sperm-binding protein Li 236P
- Extra Details:
- This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase.
- Shipping Conditions:
- Blue Ice



