[KO Validated] SIRT3 Rabbit polyclonal antibody

Size

POA

SKU:: A5718
Additional Names:: SIR2L3|T3
Application:: ELISA, WB
Molecular Weight:: 28 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Uniprot:: Q9NTG7
Synonyms:: mitochondrial nicotinamide adenine dinucleotide-dependent deacetylase;NAD-dependent deacetylase sirtuin-3, mitochondrial;NAD-dependent protein deacetylase sirtuin-3, mitochondrial;regulatory protein SIR2 homolog 3;silent mating type information regulation 2, S.cerevisiae, homolog 3;sir2-like 3;SIR2-like protein 3;SIR2L3;sirtuin type 3
Extra Details:: SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control.