A5697
PSMB4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5697
- Additional Names:
- HN3|HsN3|PRAAS3|PROS-26|PROS26|PSMB4
- Application:
- ELISA, WB
- Molecular Weight:
- 22kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEAFLGSRSGLWAGGPAPGQFYRIPSTPDSFMDPASALYRGPITRTQNPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSTETNWDIAHMISGFE
- Uniprot:
- P28070
- Synonyms:
- 26 kDa prosomal protein;HN3;hsBPROS26;HsN3;macropain beta chain;multicatalytic endopeptidase complex beta chain;PRAAS3;PROS-26;PROS26;proteasome (prosome, macropain) subunit, beta type, 4;proteasome beta chain;proteasome chain 3;proteasome subunit beta 4;proteasome subunit beta type-4;proteasome subunit beta7;proteasome subunit HsN3;proteasome subunit, beta type, 4;testis tissue sperm-binding protein Li 79P
- Extra Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.
- Shipping Conditions:
- Blue Ice