NCOA4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5695
Additional Names:: ARA70|ELE1|NCOA4|PTC3|RFG
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS
Uniprot:: Q13772
Synonyms:: 70 kDa androgen receptor coactivator;70 kDa AR-activator;Androgen receptor coactivator 70 kDa protein;androgen receptor-associated protein of 70 kDa;ARA70;ELE1;NCoA-4;nuclear receptor coactivator 4;PTC3;ret fused;RET-activating gene ELE1;Ret-activating protein ELE1;RFG
Extra Details:: This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14.

Shipping Conditions:: Blue Ice