A5684
CD58 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5684
- Additional Names:
- ag3|CD58|LFA-3|LFA3
- Application:
- ELISA, WB
- Molecular Weight:
- 70kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIP
- Uniprot:
- P19256
- Synonyms:
- ag3;CD58 antigen, (lymphocyte function-associated antigen 3);LFA-3;LFA3;lymphocyte function-associated antigen 3;surface glycoprotein LFA-3
- Extra Details:
- This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a ligand of the T lymphocyte CD2 protein, and functions in adhesion and activation of T lymphocytes. The protein is localized to the plasma membrane. Alternatively spliced transcript variants have been described.
- Shipping Conditions:
- Blue Ice