A5676
ATP7B Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5676
- Additional Names:
- ATP7B|PWD|WC1|WD|WND
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 157 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SSVSVVLSSLQLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGMDDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRHSAAADDDGDKWSLLLNGRDEE
- Uniprot:
- P35670
- Synonyms:
- ATPase, Cu(2+)- transporting, beta polypeptide;ATPase, Cu++ transporting, beta polypeptide;copper pump 2;copper-transporting ATPase 2;copper-transporting protein ATP7B;PWD;WC1;WD;Wilson disease-associated protein;WND
- Extra Details:
- This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein is a monomer, and functions as a copper-transporting ATPase which exports copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease which is characterized by copper accumulation.
- Shipping Conditions:
- Blue Ice