A5674
MECOM Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5674
- Additional Names:
- AML1-EVI-1|EVI1|KMT8E|MDS1|MDS1-EVI1|MECOM|PRDM3|RUSAT2
- Application:
- ELISA, WB
- Molecular Weight:
- 105kDa/145kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMK
- Uniprot:
- Q03112, Q13465
- Synonyms:
- AML1-EVI-1;AML1-EVI-1 fusion protein;ecotropic virus integration site 1 protein homolog;EVI1;histone-lysine N-methyltransferase MECOM;KMT8E;MDS1;MDS1 and EVI1 complex locus protein EVI1;MDS1 and EVI1 complex locus protein MDS1;MDS1-EVI1;Myelodysplasia syndrome 1 protein;myelodysplasia syndrome-associated protein 1;oncogene EVI1;PR domain 3;PRDM3;RUSAT2;zinc finger protein Evi1
- Extra Details:
- The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice



