MECOM Rabbit polyclonal antibody

Size

£152.00

SKU:: A5674
Additional Names:: AML1-EVI-1|EVI1|KMT8E|MDS1|MDS1-EVI1|MECOM|PRDM3|RUSAT2
Application:: ELISA, WB
Molecular Weight:: 105kDa/145kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MRSKGRARKLATNNECVYGNYPEIPLEEMPDADGVASTPSLNIQEPCSPATSSEAFTPKEGSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMK
Uniprot:: Q03112, Q13465
Synonyms:: AML1-EVI-1;AML1-EVI-1 fusion protein;ecotropic virus integration site 1 protein homolog;EVI1;histone-lysine N-methyltransferase MECOM;KMT8E;MDS1;MDS1 and EVI1 complex locus protein EVI1;MDS1 and EVI1 complex locus protein MDS1;MDS1-EVI1;Myelodysplasia syndrome 1 protein;myelodysplasia syndrome-associated protein 1;oncogene EVI1;PR domain 3;PRDM3;RUSAT2;zinc finger protein Evi1
Extra Details:: The protein encoded by this gene is a transcriptional regulator and oncoprotein that may be involved in hematopoiesis, apoptosis, development, and cell differentiation and proliferation. The encoded protein can interact with CTBP1, SMAD3, CREBBP, KAT2B, MAPK8, and MAPK9. This gene can undergo translocation with the AML1 gene, resulting in overexpression of this gene and the onset of leukemia. Several transcript variants encoding a few different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice