A5671
IL3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5671
- Additional Names:
- IL-3|IL3|MCGF|MULTI-CSF
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
- Uniprot:
- P08700
- Synonyms:
- colony-stimulating factor, multiple;hematopoietic growth factor;IL-3;interleukin-3;Mast cell growth factor;mast-cell growth factor;MCGF;MULTI-CSF;multilineage-colony-stimulating factor;multipotential colony-stimulating factor;P-cell stimulating factor;P-cell-stimulating factor
- Extra Details:
- The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Shipping Conditions:
- Blue Ice