A5667
CD74 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5667
- Additional Names:
- CD74|CLIP|DHLAG|HLADG|Ia-GAMMA|II|p33
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 30-40 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
- Uniprot:
- P04233
- Synonyms:
- CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated);CD74 molecule, major histocompatibility complex, class II invariant chain;DHLAG;gamma chain of class II antigens;HLA class II histocompatibility antigen gamma chain;HLA-DR antigens-associated invariant chain;HLA-DR-gamma;HLADG;Ia antigen-associated invariant chain;Ia-associated invariant chain;Ia-GAMMA;II;MHC HLA-DR gamma chain;p33
- Extra Details:
- The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice








