A5661
ABCG2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5661
- Additional Names:
- ABC15|ABCG2|ABCP|BCRP|BCRP1|BMDP|CD338|CDw338|CDw388|EST157481|GOUT1|MRX|MXR|MXR-1|MXR1|UAQTL1
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 65-80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL
- Uniprot:
- Q9UNQ0
- Synonyms:
- ABC transporter;ABC15;ABCP;ATP-binding cassette transporter G2;ATP-binding cassette, sub-family G (WHITE), member 2 (Junior blood group);BCRP;BCRP1;BMDP;breast cancer resistance protein;broad substrate specificity ATP-binding cassette transporter ABCG2;CD338;CDw338;EST157481;GOUT1;mitoxantrone resistance-associated protein;MRX;multi drug resistance efflux transport ATP-binding cassette sub-family G (WHITE) member 2;MXR;MXR-1;MXR1;placenta specific MDR protein;placenta-specific ATP-binding cassette transporter;UAQTL1;urate exporter
- Extra Details:
- The membrane-associated protein encoded by this gene is included in the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. Alternatively referred to as a breast cancer resistance protein, this protein functions as a xenobiotic transporter which may play a major role in multi-drug resistance. It likely serves as a cellular defense mechanism in response to mitoxantrone and anthracycline exposure. Significant expression of this protein has been observed in the placenta, which may suggest a potential role for this molecule in placenta tissue. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice



