A5660
TRPV4 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5660
- Additional Names:
- BCYM3|CMT2C|HMSN2C|OTRPC4|SMAL|SPSMA|SSQTL1|TRP12|TRPV4|VRL2|VROAC
- Application:
- ELISA, WB
- Molecular Weight:
- 95kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPL
- Uniprot:
- Q9HBA0
- Synonyms:
- BCYM3;CMT2C;HMSN2C;osm-9-like TRP channel 4;OSM9-like transient receptor potential channel 4;osmosensitive transient receptor potential channel 4;OTRPC4;SMAL;SPSMA;SSQTL1;transient receptor potential cation channel subfamily V member 4;transient receptor potential protein 12;TRP12;vanilloid receptor-like channel 2;Vanilloid receptor-like protein 2;vanilloid receptor-related osmotically activated channel;Vanilloid receptor-related osmotically-activated channel;VRL2;VROAC
- Extra Details:
- This gene encodes a member of the OSM9-like transient receptor potential channel (OTRPC) subfamily in the transient receptor potential (TRP) superfamily of ion channels. The encoded protein is a Ca2+-permeable, nonselective cation channel that is thought to be involved in the regulation of systemic osmotic pressure. Mutations in this gene are the cause of spondylometaphyseal and metatropic dysplasia and hereditary motor and sensory neuropathy type IIC. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice