A5654
PIAS2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5654
- Additional Names:
- ARIP3|DIP|MIZ1|PIAS2|PIASX|SIZ2|ZMIZ4
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EDGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDEEEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTPISSMSSDLPGLDFLSLIPVDPQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSSSRSETGVITSSGSNIPDIISLD
- Uniprot:
- O75928
- Synonyms:
- androgen receptor-interacting protein 3;ARIP3;DAB2-interacting protein;DIP;E3 SUMO-protein ligase PIAS2;E3 SUMO-protein transferase PIAS2;MIZ1;msx-interacting zinc finger protein;PIAS-NY protein;PIASX;protein inhibitor of activated STAT X;Protein inhibitor of activated STAT2;SIZ2;zinc finger, MIZ-type containing 4;ZMIZ4
- Extra Details:
- This gene encodes a member of the protein inhibitor of activated STAT family, which function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Isoforms of the encoded protein enhance the sumoylation of specific target proteins including the p53 tumor suppressor protein, c-Jun, and the androgen receptor. A pseudogene of this gene is located on the short arm of chromosome 4. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1.
- Shipping Conditions:
- Blue Ice



_IHC_01.jpg)