A5620
ROR2 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5620
- Additional Names:
- BDB|BDB1|NTRKR2|ROR2
- Application:
- ELISA, WB
- Molecular Weight:
- 140kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- APVVQEPRRIIIRKTEYGSRLRIQDLDTTDTGYYQCVATNGMKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQG
- Uniprot:
- Q01974
- Synonyms:
- BDB;BDB1;neurotrophic tyrosine kinase receptor-related 2;Neurotrophic tyrosine kinase, receptor-related 2;NTRKR2;tyrosine-protein kinase transmembrane receptor ROR2
- Extra Details:
- The protein encoded by this gene is a receptor protein tyrosine kinase and type I transmembrane protein that belongs to the ROR subfamily of cell surface receptors. The protein may be involved in the early formation of the chondrocytes and may be required for cartilage and growth plate development. Mutations in this gene can cause brachydactyly type B, a skeletal disorder characterized by hypoplasia/aplasia of distal phalanges and nails. In addition, mutations in this gene can cause the autosomal recessive form of Robinow syndrome, which is characterized by skeletal dysplasia with generalized limb bone shortening, segmental defects of the spine, brachydactyly, and a dysmorphic facial appearance.
- Shipping Conditions:
- Blue Ice

