PGRMC1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5619
Additional Names:: Dap1|HPR6.6|IZA|MPR|PGRMC1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 24kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KIVRGDQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTAAQQETLSDWESQFTFKYHHVGKLLKEGEEPTVYSDEEEPKDESARKND
Uniprot:: O00264
Synonyms:: Dap1;HPR6.6;IZA;membrane-associated progesterone receptor component 1;MPR;progesterone binding protein
Extra Details:: This gene encodes a putative membrane-associated progesterone steroid receptor. The protein is expressed predominantly in the liver and kidney.