A5615
DCLRE1C Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5615
- Additional Names:
- A-SCID|DCLRE1C|DCLREC1C|RS-SCID|SCIDA|SNM1C
- Application:
- ELISA, WB
- Molecular Weight:
- 90kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLECSLKVYLYCSPVTKELLLTSPKYRFWKKRIISIEIETPTQISLVDEASGEKEEIVVTLLPAGHCPGSVMFLFQGNNGTVLYTGDFRLAQGEAARMELLHSGGRVKDIQSVYLDTTFCDPRFYQIPSREECLSGVLELVRSWITRSPYHVVWLNCKAAYGYEYLFTNLSEELGVQVHVNKLDMFRNMPEILHHLTTDRNTQIHACRHPKAEEYFQWSKLPCGITSRNRIPLHIISIKPSTMWFGERSRK
- Uniprot:
- Q96SD1
- Synonyms:
- A-SCID;DCLREC1C;DNA cross-link repair 1C (PSO2 homolog, S. cerevisiae);DNA cross-link repair 1C protein;Protein A-SCID;protein artemis;RS-SCID;SCIDA;severe combined immunodeficiency, type a (Athabascan);SNM1 homolog C;SNM1-like protein;SNM1C
- Extra Details:
- This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The encoded protein has single-strand-specific 5'-3' exonuclease activity; it also exhibits endonuclease activity on 5' and 3' overhangs and hairpins. The protein also functions in the regulation of the cell cycle in response to DNA damage. Mutations in this gene can cause Athabascan-type severe combined immunodeficiency (SCIDA) and Omenn syndrome. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice