ZEB1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5600
Additional Names:: AREB6|BZP|DELTAEF1|FECD6|NIL2A|PPCD3|TCF8|ZEB1|ZFHEP|ZFHX1A
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 200 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: INIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEPPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKTE
Uniprot:: P37275
Synonyms:: AREB6;BZP;delta-crystallin enhancer binding factor 1;DELTAEF1;FECD6;negative regulator of IL2;NIL-2-A zinc finger protein;NIL2A;posterior polymorphous corneal dystrophy 3;PPCD3;TCF8;Transcription factor 8;transcription factor 8 (represses interleukin 2 expression);ZFHEP;ZFHX1A;zinc finger E-box-binding homeobox 1;zinc finger homeodomain enhancer-binding protein
Extra Details:: This gene encodes a zinc finger transcription factor. The encoded protein likely plays a role in transcriptional repression of interleukin 2. Mutations in this gene have been associated with posterior polymorphous corneal dystrophy-3 and late-onset Fuchs endothelial corneal dystrophy. Alternatively spliced transcript variants encoding different isoforms have been described.