TWIST2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5599
Additional Names:: AMS|BBRSAY|bHLHa39|DERMO1|FFDD3|SETLSS|TWIST2
Application:: ELISA, WB
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDK
Uniprot:: Q8WVJ9
Synonyms:: AMS;BBRSAY;bHLHa39;class A basic helix-loop-helix protein 39;dermis-expressed protein 1;DERMO1;FFDD3;SETLSS;twist basic helix-loop-helix transcription factor 2;twist homolog 2;twist-related bHLH protein Dermo1;twist-related protein 2
Extra Details:: The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found.