CGRP Rabbit polyclonal antibody

Size

£152.00

SKU:: A5542
Additional Names:: CALC1|CGRP|CGRP-alpha|CGRP-I|CGRP1|CT|KC|PCT
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLLAALVQDYVQMKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFGRRRRDLQA
Uniprot:: P01258, P06881
Synonyms:: alpha-type CGRP;CALC1;calcitonin;calcitonin 1;calcitonin gene-related peptide 1;calcitonin gene-related peptide I;calcitonin/calcitonin-related polypeptide, alpha;CGRP;CGRP-alpha;CGRP-I;CGRP1;CT;katacalcin;KC;PCT
Extra Details:: This gene encodes the peptide hormones calcitonin, calcitonin gene-related peptide and katacalcin by tissue-specific alternative RNA splicing of the gene transcripts and cleavage of inactive precursor proteins. Calcitonin is involved in calcium regulation and acts to regulate phosphorus metabolism. Calcitonin gene-related peptide functions as a vasodilator and as an antimicrobial peptide while katacalcin is a calcium-lowering peptide. Multiple transcript variants encoding different isoforms have been found for this gene.