A5484
PSRC1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A5484
- Additional Names:
- DDA3|FP3214|PSRC1
- Application:
- ELISA, WB
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQGVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLKDSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNLFPASKSPASSPLTRSTPPVRGRAGPSGRAAASEET
- Uniprot:
- Q6PGN9
- Synonyms:
- DDA3;differential display and activated by p53;FP3214;p53-regulated DDA3;proline/serine-rich coiled-coil 1;proline/serine-rich coiled-coil protein 1
- Extra Details:
- This gene encodes a proline-rich protein that is a target for regulation by the tumor suppressor protein p53. The encoded protein plays an important role in mitosis by recruiting and regulating microtubule depolymerases that destabalize microtubules. Alternatively spliced transcript variants encoding different isoforms have been described.
- Shipping Conditions:
- Blue Ice