[KO Validated] LITAF Rabbit polyclonal antibody

Size

POA

SKU:: A5469
Additional Names:: AF|PIG7|SIMPLE|TP53I7
Application:: ELISA, WB, IHC-P, IP
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Uniprot:: Q99732
Synonyms:: lipopolysaccharide-induced TNF-alpha factor;lipopolysaccharide-induced tumor necrosis factor-alpha factor;LPS-induced TNF-alpha factor;p53-induced gene 7 protein;PIG7;SIMPLE;small integral membrane protein of lysosome/late endosome;TP53I7;tumor protein p53 inducible protein 7
Extra Details:: Lipopolysaccharide is a potent stimulator of monocytes and macrophages, causing secretion of tumor necrosis factor-alpha (TNF-alpha) and other inflammatory mediators. This gene encodes lipopolysaccharide-induced TNF-alpha factor, which is a DNA-binding protein and can mediate the TNF-alpha expression by direct binding to the promoter region of the TNF-alpha gene. The transcription of this gene is induced by tumor suppressor p53 and has been implicated in the p53-induced apoptotic pathway. Mutations in this gene cause Charcot-Marie-Tooth disease type 1C (CMT1C) and may be involved in the carcinogenesis of extramammary Paget's disease (EMPD). Multiple alternatively spliced transcript variants have been found for this gene.

Shipping Conditions:: Blue Ice