ACVR1B Rabbit polyclonal antibody

Size

£152.00

SKU:: A5453
Additional Names:: ACTRIB|ACVR1B|ACVRLK4|ALK4|SKR2
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Uniprot:: P36896
Synonyms:: activin A receptor, type IB;activin A receptor, type II-like kinase 4;Activin receptor type IB;activin receptor type-1B;activin receptor-like kinase 4;ACTRIB;ACVRLK4;ALK4;serine/threonine-protein kinase receptor R2;SKR2
Extra Details:: This gene encodes an activin A type IB receptor. Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I and two type II receptors. This protein is a type I receptor which is essential for signaling. Mutations in this gene are associated with pituitary tumors. Alternate splicing results in multiple transcript variants.