A5446
CBR1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5446
- Additional Names:
- CBR|CBR1|hCBR1|PG-9-KR|SDR21C1
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSSGIHVALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAGIAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW
- Uniprot:
- P16152
- Synonyms:
- 15-hydroxyprostaglandin dehydrogenase;15-hydroxyprostaglandin dehydrogenase [NADP(+)];20-beta-hydroxysteroid dehydrogenase;carbonyl reductase (NADPH) 1;carbonyl reductase [NADPH] 1;CBR;epididymis secretory sperm binding protein;hCBR1;NADPH-dependent carbonyl reductase 1;PG-9-KR;prostaglandin 9-ketoreductase;prostaglandin-E(2) 9-reductase;SDR21C1;short chain dehydrogenase/reductase family 21C member 1
- Extra Details:
- The protein encoded by this gene belongs to the short-chain dehydrogenases/reductases (SDR) family, which function as NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds, such as quinones, prostaglandins, and various xenobiotics. Alternatively spliced transcript variants have been found for this gene.
- Shipping Conditions:
- Blue Ice

