A5441
PI3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A5441
- Additional Names:
- cementoin|ESI|PI3|SKALP|WAP3|WFDC14
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 12kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
- Uniprot:
- P19957
- Synonyms:
- cementoin;elafin;elastase-specific inhibitor;ESI;Peptidase inhibitor 3;peptidase inhibitor 3, skin-derived;PI-3;pre-elafin;protease inhibitor 3, skin-derived (SKALP);protease inhibitor WAP3;SKALP;skin-derived antileukoproteinase;trappin-2;WAP four-disulfide core domain 14;WAP four-disulfide core domain protein 14;WAP3;WFDC14
- Extra Details:
- This gene encodes an elastase-specific inhibitor that functions as an antimicrobial peptide against Gram-positive and Gram-negative bacteria, and fungal pathogens. The protein contains a WAP-type four-disulfide core (WFDC) domain, and is thus a member of the WFDC domain family. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. Expression of this gene is upgulated by bacterial lipopolysaccharides and cytokines.
- Shipping Conditions:
- Blue Ice





