[KO Validated] GARS Rabbit polyclonal antibody

Size

POA

SKU:: A5435
Additional Names:: CMT2D|DSMAV|GARS|GlyRS|HMN5|HMN5A|RS|SMAD1|SMAJI
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 76kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDIVDRAKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEIDCTMLTPEPVLKTSGHVDKFADFMVKDVKNGECFRADHLLKAHLQKLMSDKKCSVEKKSEMESVLAQLDNYGQQELADLFVNYNVKSPITGNDLSPPVSFNLMFKTFIGPGGNMPGYLRPETAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPSEKDHPKFQNVAD
Uniprot:: P41250
Synonyms:: AP-4-A synthetase;ap4A synthetase;Charcot-Marie-Tooth neuropathy 2D;Charcot-Marie-Tooth neuropathy, neuronal type, D;CMT2D;diadenosine tetraphosphate synthetase;DSMAV;GARS;glycine--tRNA ligase;Glycyl-tRNA synthetase;Glycyl-tRNA synthetase 1;GlyRS;HMN5;HMN5A;SMAD1;SMAJI
Extra Details:: This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice