Annexin A6/Annexin VI Rabbit polyclonal antibody

Size

£152.00

SKU:: A5390
Additional Names:: Annexin A6/Annexin VI|ANX6|CBP68|CPB-II|p68|p70
Application:: ELISA, WB
Molecular Weight:: 72kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAVVKCIR
Uniprot:: P08133
Synonyms:: 67 kDa calelectrin;annexin A6;Annexin VI;annexin VI (p68);annexin-6;ANX6;calcium-binding protein p68;calelectrin;calphobindin II;Calphobindin-II;CBP68;chromobindin-20;CPB-II;lipocortin VI;p68;p70;Protein III;testis secretory sperm-binding protein Li 198a
Extra Details:: Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis. Alternatively spliced transcript variants have been described.

Shipping Conditions:: Blue Ice