ADAM9 Rabbit polyclonal antibody

Size

£152.00

SKU:: A5388
Additional Names:: ADAM9|CORD9|MCMP|MDC9|Mltng
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 100 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AARPGFQQTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPEDFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFGLRGLLHLENASYGIEPLQNSSHFEHIIYRMDDVYKEPLKCGVSNKDIEKETAKDEEEEPPSMTQLLRRRRAVLPQ
Uniprot:: Q13443
Synonyms:: ADAM metallopeptidase domain 9 (meltrin gamma);cellular disintegrin-related protein;cone rod dystrophy 9;CORD9;disintegrin and metalloproteinase domain-containing protein 9;MCMP;MDC9;Meltrin-gamma;metalloprotease/disintegrin/cysteine-rich protein 9;Mltng;myeloma cell metalloproteinase
Extra Details:: This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Several alternatively spliced transcript variants have been identified for this gene.

Shipping Conditions:: Blue Ice